DNA2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DNA2L antibody: synthetic peptide directed towards the middle region of human DNA2L. Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	DNA replication helicase/nuclease 2
Database Link	NP_001073918 Entrez Gene 1763 Human UniProt ID P51530
Background	DNA2 is a conserved helicase/nuclease involved inThe maintenance of mitochondrial and nuclear DNA stability (Duxin et al., 2009 [PubMed 19487465]). [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (1) representsThe longer transcript and encodesThe functional protein. CCDS Note:The coding region has been updated to shortenThe N-terminus to one that is more supported byThe available transcript, conservation and publication data. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: D42046.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end.
Synonyms	DNA2L; hDNA2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Rabbit: 85%; Guinea pig: 85%
Reference Data
Protein Pathways	DNA replication

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.