DNA2 Rabbit Polyclonal Antibody
CAT#: TA341636
Rabbit Polyclonal Anti-DNA2L Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 4,840.00
CN¥ 300.00
CN¥ 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DNA2L antibody: synthetic peptide directed towards the middle region of human DNA2L. Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | DNA replication helicase/nuclease 2 |
Database Link | |
Background | DNA2 is a conserved helicase/nuclease involved inThe maintenance of mitochondrial and nuclear DNA stability (Duxin et al., 2009 [PubMed 19487465]). [supplied by OMIM, Nov 2010]. Transcript Variant:This variant (1) representsThe longer transcript and encodesThe functional protein. CCDS Note:The coding region has been updated to shortenThe N-terminus to one that is more supported byThe available transcript, conservation and publication data. Publication Note:This RefSeq record includes a subset ofThe publications that are available forThis gene. Please seeThe Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: D42046.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete onThe 3' end. |
Synonyms | DNA2L; hDNA2 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 92%; Rat: 86%; Horse: 86%; Rabbit: 85%; Guinea pig: 85% |
Reference Data | |
Protein Pathways | DNA replication |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |