MTREX Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SKIV2L2 antibody: synthetic peptide directed towards the N terminal of human SKIV2L2. Synthetic peptide located within the following region: KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	118 kDa
Gene Name	Ski2 like RNA helicase 2
Database Link	NP_056175 Entrez Gene 23517 Human UniProt ID P42285
Background	SKIV2L2 may be involved in pre-mRNA splicing.
Synonyms	Dob1; fSAP118; KIAA0052; Mtr4
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rabbit: 100%; Horse: 86%; Bovine: 86%; Pig: 85%; Mouse: 85%; Guinea pig: 85%
Reference Data
Protein Pathways	RNA degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.