EIF4A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EIF4A3 antibody: synthetic peptide directed towards the N terminal of human EIF4A3. Synthetic peptide located within the following region: RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	eukaryotic translation initiation factor 4A3
Database Link	NP_055555 Entrez Gene 9775 Human UniProt ID P38919
Background	This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The protein encoded byThis gene is a nuclear matrix protein. Its amino acid sequence is highly similar toThe amino acid sequences ofThe translation initiation factors eIF4AI and eIF4AII, two other members ofThe DEAD box protein family. [provided by RefSeq, Jul 2008]
Synonyms	DDX48; eIF4AIII; MUK34; NMP265; NUK34; RCPS
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 86%; Goat: 85%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Spliceosome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.