DDX58 Rabbit Polyclonal Antibody

CAT#: TA341588

Rabbit Polyclonal Anti-DDX58 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58. Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 106 kDa
Gene Name DEXD/H-box helicase 58
Background DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure.This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition andThe regulation of immune response. [provided by RefSeq, Jul 2008]
Synonyms RIG-I; RIGI; RLR-1
Note Immunogen Sequence Homology: Human: 100%; Horse: 79%
Reference Data
Protein Pathways Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...