Helicase SKI2W (SKIV2L) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SKIV2L antibody: synthetic peptide directed towards the middle region of human SKIV2L. Synthetic peptide located within the following region: SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	138 kDa
Gene Name	Ski2 like RNA helicase
Database Link	NP_008860 Entrez Gene 6499 Human UniProt ID Q15477
Background	DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene encodes a DEAD box protein, which is a human homologue of yeast SKI2 and may be involved in antiviral activity by blocking translation of poly(A) deficient mRNAs.This gene is located inThe class III region ofThe major histocompatibility complex. [provided by RefSeq, Jul 2008]
Synonyms	170A; DDX13; HLP; SKI2; SKI2W; SKIV2; SKIV2L1; THES2
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 79%
Reference Data
Protein Pathways	RNA degradation

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.