DDX39 (DDX39A) Rabbit Polyclonal Antibody
CAT#: TA341576
Rabbit Polyclonal Anti-DDX39 Antibody
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DDX39 antibody: synthetic peptide directed towards the N terminal of human DDX39. Synthetic peptide located within the following region: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 47 kDa |
Gene Name | DEAD-box helicase 39A |
Database Link | |
Background | This gene encodes a member ofThe DEAD box protein family.These proteins are characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD) and are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.This gene is thought to play a role inThe prognosis of patients with gastrointestinal stromal tumors. A pseudogene ofThis gene is present on chromosome 13. Alternate splicing results in multiple transcript variants. Additional alternatively spliced transcript variants ofThis gene have been described, butTheir full-length nature is not known. [provided by RefSeq, Sep 2013] |
Synonyms | BAT1; BAT1L; DDX39; DDXL; URH49 |
Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rat: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%; Bovine: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |