DDX23 Rabbit Polyclonal Antibody

CAT#: TA341572

Rabbit Polyclonal Anti-DDX23 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 (DDX23)
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 (DDX23), 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 (DDX23), 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-DDX23 antibody: synthetic peptide directed towards the C terminal of human DDX23. Synthetic peptide located within the following region: EDSAVFYELKQAILESPVSSCPPELANHPDAQHKPGTILTKKRREETIFA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 90 kDa
Gene Name DEAD-box helicase 23
Background This gene encodes a member ofThe DEAD box protein family. DEAD box proteins, characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThis family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The protein encoded byThis gene is a component ofThe U5 snRNP complex; it may facilitate conformational changes inThe spliceosome during nuclear pre-mRNA splicing. An alternatively spliced transcript variant has been found forThis gene, but its biological validity has not been determined. [provided by RefSeq, Jul 2008]
Synonyms prp28; PRPF28; SNRNP100; U5-100K; U5-100KD
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Pathways Spliceosome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...