AKAP1 Rabbit Polyclonal Antibody
CAT#: TA341554
Rabbit Polyclonal Anti-AKAP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AKAP1 antibody: synthetic peptide directed towards the C terminal of human AKAP1. Synthetic peptide located within the following region: VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | A-kinase anchoring protein 1 |
Database Link | |
Background | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which haveThe common function of binding toThe regulatory subunit of protein kinase A (PKA) and confiningThe holoenzyme to discrete locations withinThe cell.This gene encodes a member ofThe AKAP family.The encoded protein binds to type I and type II regulatory subunits of PKA and anchorsThem toThe mitochondrion.This protein is speculated to be involved inThe cAMP-dependent signal transduction pathway and in directing RNA to a specific cellular compartment. [provided by RefSeq, Jul 2008] |
Synonyms | AKAP; AKAP84; AKAP121; AKAP149; D-AKAP1; MGC1807; PRKA1; SAKAP84 |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |