CCDC17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CCDC17 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC17. Synthetic peptide located within the following region: ARIQELQAEPGNPLSSRREAELYSPVQKANPGTLAAEIRALREAYIRDGG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	67 kDa
Gene Name	coiled-coil domain containing 17
Database Link	NP_001177111 Entrez Gene 149483 Human UniProt ID Q96LX7
Background	The function ofThis protein remains unknown.
Synonyms	RP4-697E16.4
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.