ZNF276 Rabbit Polyclonal Antibody
CAT#: TA341469
Rabbit Polyclonal Anti-ZNF276 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 3,080.00
CNY 4,840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF276 antibody: synthetic peptide directed towards the middle region of human ZNF276. Synthetic peptide located within the following region: SFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 60 kDa |
Gene Name | zinc finger protein 276 |
Database Link | |
Background | May be involved in transcriptional regulation. |
Synonyms | CENP-Z; CENPZ; ZADT; ZFP276; ZNF477 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |