Activin A Receptor Type IC (ACVR1C) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	activin A receptor type 1C
Database Link	NP_660302 Entrez Gene 130399 Human UniProt ID Q8NER5
Background	ACVR1C is a type I receptor for the TGFB family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors.ACVR1C is a type I receptor for the TGFB (see MIM 190180) family of signaling molecules. Upon ligand binding, type I receptors phosphorylate cytoplasmic SMAD transcription factors, which then translocate to the nucleus and interact directly with DNA or in complex with other transcription factors (Bondestam et al., 2001 [PubMed 12063393]). [supplied by OMIM]
Synonyms	ACVRLK7; ALK7
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Rat: 86%; Dog: 83%; Pig: 81%; Guinea pig: 80%
Reference Data
Protein Families	Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways	Adherens junction, Chronic myeloid leukemia, Colorectal cancer, Endocytosis, MAPK signaling pathway, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.