SERPINB1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SERPINB1 antibody: synthetic peptide directed towards the middle region of human SERPINB1. Synthetic peptide located within the following region: RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	serpin family B member 1
Database Link	NP_109591 Entrez Gene 1992 Human UniProt ID P30740
Background	SERPINB1 regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
Synonyms	EI; ELANH2; HEL-S-27; HEL57; LEI; M; MNEI; NEI; PI-2; PI2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Mouse: 93%; Rat: 92%; Sheep: 86%; Bovine: 86%; Horse: 85%; Pig: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.