TOE1 Rabbit Polyclonal Antibody

CAT#: TA340199

Rabbit Polyclonal Anti-TOE1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of target of EGR1, member 1 (nuclear) (TOE1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human target of EGR1, member 1 (nuclear) (TOE1), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human target of EGR1, member 1 (nuclear) (TOE1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-TOE1 antibody: synthetic peptide directed towards the N terminal of human TOE1. Synthetic peptide located within the following region: VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 56 kDa
Gene Name target of EGR1, member 1 (nuclear)
Background TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.
Synonyms FLJ13949
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Protein Families Stem cell - Pluripotency, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...