EEF1B2 Rabbit Polyclonal Antibody

CAT#: TA340194

Rabbit Polyclonal Anti-EEF1B2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1
    • 100 ug

CNY 3,080.00


Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EEF1B2 antibody: synthetic peptide directed towards the middle region of human EEF1B2. Synthetic peptide located within the following region: VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name eukaryotic translation elongation factor 1 beta 2
Background EEF1B2 is a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
Synonyms EEF1B; EEF1B1; EF1B
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Goat: 86%; Bovine: 86%; Mouse: 85%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...