EXOC3 Rabbit Polyclonal Antibody

CAT#: TA340172

Rabbit Polyclonal Anti-EXOC3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of exocyst complex component 3 (EXOC3)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human exocyst complex component 3 (EXOC3), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human exocyst complex component 3 (EXOC3), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-EXOC3 antibody: synthetic peptide directed towards the middle region of human EXOC3. Synthetic peptide located within the following region: LERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 85 kDa
Gene Name exocyst complex component 3
Background EXOC3 is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity.
Synonyms SEC6; SEC6L1; Sec6p
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
Protein Pathways Tight junction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...