C7orf16 (PPP1R17) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C7orf16 antibody: synthetic peptide directed towards the middle region of human C7orf16. Synthetic peptide located within the following region: IKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	protein phosphatase 1 regulatory subunit 17
Database Link	NP_006649 Entrez Gene 10842 Human UniProt ID O96001
Background	The function of C7orf16 remains unknown.
Synonyms	C7orf16; GSBS
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 85%
Reference Data
Protein Pathways	Long-term depression

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.