WASF3 Rabbit Polyclonal Antibody

CAT#: TA340127

Rabbit Polyclonal Anti-WASF3 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Chicken, Turkey
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-WASF3 antibody: synthetic peptide directed towards the middle region of human WASF3. Synthetic peptide located within the following region: RIDGTTREVKKVRKARNRRQEWNMMAYDKELRPDNRLSQSVYHGASSEGS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 55 kDa
Gene Name WAS protein family member 3
Background WASF3 is a member of the Wiskott-Aldrich syndrome protein family. It is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function.This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms Brush-1; SCAR3; WAVE3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Adherens junction, Fc gamma R-mediated phagocytosis
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...