CFDP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CFDP1 antibody: synthetic peptide directed towards the middle region of human CFDP1. Synthetic peptide located within the following region: GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	craniofacial development protein 1
Database Link	NP_006315 Entrez Gene 10428 Human UniProt ID Q9UEE9
Background	CFDP1 may play a role during embryogenesis.
Synonyms	BCNT; BUCENTAUR; CENP-29; CP27; p97; SWC5; Yeti
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.