NET1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NET1 antibody: synthetic peptide directed towards the middle region of human NET1. Synthetic peptide located within the following region: AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	neuroepithelial cell transforming 1
Database Link	NP_005854 Entrez Gene 10276 Human UniProt ID Q7Z628
Background	NET1 acts as guanine nucleotide exchange factor (GEF) for RhoA GTPase. It may be involved in activation of the SAPK/JNK pathway.
Synonyms	ARHGEF8; NET1A
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Yeast: 90%; Mouse: 86%; Bovine: 86%; Zebrafish: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.