Cardiotrophin 1 (CTF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CTF1 antibody: synthetic peptide directed towards the N terminal of human CTF1. Synthetic peptide located within the following region: MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	cardiotrophin 1
Database Link	NP_001321 Entrez Gene 1489 Human UniProt ID Q16619
Background	CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.
Synonyms	CT-1; CT1
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Bovine: 93%; Pig: 92%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Secreted Protein
Protein Pathways	Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.