CHI3L1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	WB, IF
Reactivity	Human, SimianIVE
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHI3L1 antibody: synthetic peptide directed towards the middle region of human CHI3L1. Synthetic peptide located within the following region: LDFISIMTYDFHGAWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	chitinase 3 like 1
Database Link	NP_001267 Entrez Gene 1116 Human UniProt ID P36222
Background	CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment. CHI3L1 may play a role in tissue remodeling and defense against pathogens. It belongs to the glycosyl hydrolase 18 family. CHI3L1 may play an important role in the capacity of cells to respond to and cope with changes in their environment.
Synonyms	ASRT7; CGP-39; GP-39; GP39; HC-gp39; HCGP-3P; hCGP-39; YKL-40; YKL40; YYL-40
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 92%; Goat: 92%; Bovine: 92%; Dog: 77%; Rat: 77%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.