Ap1g1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ap1g1 antibody is: synthetic peptide directed towards the middle region of Mouse Ap1g1. Synthetic peptide located within the following region: TPVIPTAPTSKPASAGGELLDLLGDITLTGAPAAAPTPASVPQISQPPFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	adaptor protein complex AP-1, gamma 1 subunit
Database Link	NP_033807 Entrez Gene 11765 Mouse UniProt ID P22892
Background	The function of this protein remains unknown.
Synonyms	ADTG; CLAPG1; gamma1-adaptin; MGC18255
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.