Carboxypeptidase N subunit 2 (CPN2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CPN2 antibody: synthetic peptide directed towards the N terminal of human CPN2. Synthetic peptide located within the following region: FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	carboxypeptidase N subunit 2
Database Link	NP_001073982 Entrez Gene 1370 Human UniProt ID P22792
Background	CPN2 contains 13 LRR (leucine-rich) repeats. The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.
Synonyms	ACBP
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 91%; Mouse: 91%; Bovine: 91%; Horse: 86%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.