Casein Kinase 1 alpha (CSNK1A1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CSNK1A1 antibody: synthetic peptide directed towards the C terminal of human CSNK1A1. Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	casein kinase 1 alpha 1
Database Link	NP_001883 Entrez Gene 1452 Human UniProt ID P48729
Background	CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.
Synonyms	CK1; CK1a; CKIa; HEL-S-77p; HLCDGP1; PRO2975
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
Protein Pathways	Hedgehog signaling pathway, Wnt signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.