SULT2B1 Rabbit Polyclonal Antibody

CAT#: TA339866

Rabbit Polyclonal Anti-SULT2B1 Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Transient overexpression lysate of sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2
    • 100 ug

CN¥ 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the N terminal of human SULT2B1. Synthetic peptide located within the following region: MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 39 kDa
Gene Name sulfotransferase family 2B member 1
Background Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and
Synonyms HSST2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Pathways Androgen and estrogen metabolism, Sulfur metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...