Rbpj Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Rbpj antibody is: synthetic peptide directed towards the middle region of Mouse Rbpj. Synthetic peptide located within the following region: MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	recombination signal binding protein for immunoglobulin kappa J region
Database Link	NP_001074396 Entrez Gene 19664 Mouse UniProt ID P31266
Background	The function of this protein remains unknown.
Synonyms	CBF-1; CBF1; csl; IGKJRB; IGKJRB1; KBF2; MGC61669; OTTHUMP00000123441; RBP-J; RBP-JK; RBPJK; RBPSUH; SUH
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.