YB1 (YBX1) Rabbit Polyclonal Antibody

CAT#: TA339853

Rabbit Polyclonal Anti-YBX1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of Y box binding protein 1 (YBX1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Purified recombinant protein of Homo sapiens Y box binding protein 1 (YBX1), 20 µg
    • 20 ug

CNY 2,900.00


Purified recombinant protein of Homo sapiens Y box binding protein 1 (YBX1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-YBX1 antibody is: synthetic peptide directed towards the C-terminal region of Human YBX1. Synthetic peptide located within the following region: PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name Y-box binding protein 1
Background YBX1 binds to splice sites in pre-mRNA and regulates splice site selection. YBX1 binds and stabilizes cytoplasmic mRNA. YBX1 contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. YBX1 binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. YBX1 regulates the transcription of numerous genes. YBX1 promotes separation of DNA strands that contain mismatches or are modified by cisplatin. YBX1 has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). YBX1 may play a role in DNA repair. YBX1 is the component of the CRD-mediated complex that promotes MYC mRNA stability.
Synonyms BP-8; CSDA2; CSDB; DBPB; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families ES Cell Differentiation/IPS, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...