YB1 (YBX1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-YBX1 antibody is: synthetic peptide directed towards the C-terminal region of Human YBX1. Synthetic peptide located within the following region: PYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	Y-box binding protein 1
Database Link	NP_004550 Entrez Gene 4904 Human UniProt ID P67809
Background	YBX1 binds to splice sites in pre-mRNA and regulates splice site selection. YBX1 binds and stabilizes cytoplasmic mRNA. YBX1 contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. YBX1 binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. YBX1 regulates the transcription of numerous genes. YBX1 promotes separation of DNA strands that contain mismatches or are modified by cisplatin. YBX1 has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). YBX1 may play a role in DNA repair. YBX1 is the component of the CRD-mediated complex that promotes MYC mRNA stability.
Synonyms	BP-8; CSDA2; CSDB; DBPB; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Protein Families	ES Cell Differentiation/IPS, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.