ZNF517 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF517 antibody: synthetic peptide directed towards the middle region of human ZNF517. Synthetic peptide located within the following region: HYRLHSGERPYRCRACGRACSRLSTLIQHQKVHGREPGEDTEGRRAPCWA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	zinc finger protein 517
Database Link	NP_998770 Entrez Gene 340385 Human UniProt ID Q6ZMY9
Background	The exact function of ZNF517 remains unknown.
Synonyms	zinc finger protein 517
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.