SRFBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SRFBP1 antibody: synthetic peptide directed towards the N terminal of human SRFBP1. Synthetic peptide located within the following region: LKSKKGTEDALLKNQRRAQRLLEEIHAMKELKPDIVTKSALGDDINFEKI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	serum response factor binding protein 1
Database Link	NP_689759 Entrez Gene 153443 Human UniProt ID Q8NEF9
Background	SRFBP1 may be involved in regulating transcriptional activation of cardiac genes during the aging process. It may play a role in biosynthesis and/or processing of SLC2A4 in adipose cells.
Synonyms	BUD22; P49; p49; Rlb1; STRAP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.