GABPB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MGC29891 antibody: synthetic peptide directed towards the C terminal of human MGC29891. Synthetic peptide located within the following region: EEEKLPLTKKPRIGEKTNSVEESKEGNERELLQQQLQEANRRAQEYRHQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	GA binding protein transcription factor beta subunit 2
Database Link	NP_653219 Entrez Gene 126626 Human UniProt ID Q8TAK5
Background	MGC29891 (GABPB2) contains 5 ANK repeats. It may function as transcription factor capable of interacting with purine rich repeats (GA repeats).
Synonyms	GABPB-2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%; Zebrafish: 83%; Yeast: 82%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.