DNER Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DNER antibody: synthetic peptide directed towards the middle region of human DNER. Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	delta/notch like EGF repeat containing
Database Link	NP_620711 Entrez Gene 92737 Human UniProt ID Q8NFT8
Background	DNER is an activator of the NOTCH1 pathway. It may mediate neuron-glia interaction during astrocytogenesis.
Synonyms	bet; UNQ26
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.