Zinc finger protein 460 (ZNF460) Rabbit Polyclonal Antibody

CAT#: TA339705

Rabbit Polyclonal Anti-ZNF460 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of zinc finger protein 460 (ZNF460)
    • 100 ug

CNY 4,840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF460 antibody: synthetic peptide directed towards the N terminal of human ZNF460. Synthetic peptide located within the following region: ALYVEVMLETCGLLVALGDSTKPETVEPIPSHLALPEEVSLQEQLAQGVP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 64 kDa
Gene Name zinc finger protein 460
Background ZNF460 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF460 may be involved in transcriptional regulation.Zinc finger proteins, such as ZNF272, interact with nucleic acids and have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form 1 family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-322 DA991801.1 1-322 323-2011 BC118625.1 1-1689 2012-3494 AC005261.2 120007-121489 3495-3849 AK074582.1 1463-1817
Synonyms HZF8; ZNF272
Note Immunogen Sequence Homology: Human: 100%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...