Securin 2 (PTTG2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTTG2 antibody: synthetic peptide directed towards the middle region of human PTTG2. Synthetic peptide located within the following region: DAPSALPKATRKALGTVNRATEKSVKTNGPRKQKQPSFSAKKMTEKTVKT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	pituitary tumor-transforming 2
Database Link	NP_006598 Entrez Gene 10744 Human UniProt ID Q9NZH5
Background	PTTG2 belongs to the securin family. The N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.
Synonyms	PTTG2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Horse: 86%; Mouse: 86%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Cell cycle, Oocyte meiosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.