Sprouty 3 (SPRY3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPRY3 antibody: synthetic peptide directed towards the N terminal of human SPRY3. Synthetic peptide located within the following region: ALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	sprouty RTK signaling antagonist 3
Database Link	NP_005831 Entrez Gene 10251 Human UniProt ID O43610
Background	SPRY3 contains 1 B30.2/SPRY domain. Sprouty/Caveolin-1 interaction modulates signaling in a growth factor- and Sprouty isoform-specific manner. Spry 1, 2 and 3 expression was observed in placental tissue from all three trimestersl. The exact function of SPRY3 remains unknown.
Synonyms	spry-3
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Pathways	Jak-STAT signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.