ZNHIT3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNHIT3 antibody: synthetic peptide directed towards the N terminal of human ZNHIT3. Synthetic peptide located within the following region: HKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	zinc finger HIT-type containing 3
Database Link	NP_004764 Entrez Gene 9326 Human UniProt ID Q15649
Background	ZNHIT3 contains 1 HIT-type zinc finger. The exact function of ZNHIT3 remains unknown.
Synonyms	TRIP3
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.