EIF3S3 (EIF3H) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EIF3H antibody: synthetic peptide directed towards the C terminal of human EIF3H. Synthetic peptide located within the following region: LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	eukaryotic translation initiation factor 3 subunit H
Database Link	NP_003747 Entrez Gene 8667 Human UniProt ID O15372
Background	EIF3H belongs to the peptidase M67 family. It contains 1 MPN (JAB/Mov34) domain. EIF3H binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. It associates with the p170 subunit of EIF3.
Synonyms	eIF3-gamma; eIF3-p40; EIF3S3
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 75%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.