HELT Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HELT antibody: synthetic peptide directed towards the middle region of human HELT. Synthetic peptide located within the following region: EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	helt bHLH transcription factor
Database Link	NP_001025058 Entrez Gene 391723 Human UniProt ID A6NFD8
Background	HELT belongs to the HEY family. It contains 1 basic helix-loop-helix (bHLH) domain and 1orange domain. HELT is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.
Synonyms	bHLHb44; HCM1228; HESL; Mgn
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.