ATP5MK Rabbit Polyclonal Antibody
CAT#: TA339625
Rabbit Polyclonal Anti-USMG5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-USMG5 antibody: synthetic peptide directed towards the N terminal of human USMG5. Synthetic peptide located within the following region: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 6 kDa |
Gene Name | up-regulated during skeletal muscle growth 5 homolog (mouse) |
Database Link | |
Background | The function of USMG5 remains unknown. |
Synonyms | bA792D24.4; DAPIT; HCVFTP2 |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 85%; Dog: 79%; Bovine: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |