PIGO Rabbit Polyclonal Antibody

CAT#: TA339619

Rabbit Polyclonal Anti-PIGO Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PIGO antibody: synthetic peptide directed towards the N terminal of human PIGO. Synthetic peptide located within the following region: LIDALRFDFAQPQHSHVPREPPVSLPFLGKLSSLQRILEIQPHHARLYRS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 74 kDa
Gene Name phosphatidylinositol glycan anchor biosynthesis class O
Background PIGO is a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. PIGO is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI.This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid which contains three mannose molecules in its core backbone. The GPI-anchor is found on many blood cells and serves to anchor proteins to the cell surface. This protein is involved in the transfer of ethanolaminephosphate (EtNP) to the third mannose in GPI. At least two alternatively spliced transcripts encoding distinct isoforms have been found for this gene.
Synonyms HPMRS2
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 92%
Reference Data
Protein Families Transmembrane
Protein Pathways Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...