CDA08 (ITFG1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ITFG1 antibody: synthetic peptide directed towards the N terminal of human ITFG1. Synthetic peptide located within the following region: TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	integrin alpha FG-GAP repeat containing 1
Database Link	NP_110417 Entrez Gene 81533 Human UniProt ID Q8TB96
Background	ITFG1 belongs to the TIP family. It contains 1 FG-GAP repeat. ITFG1 is a modulator of T-cell function. It has a protective effect in graft versus host disease model.
Synonyms	2310047C21Rik; CDA08; LNKN-1; TIP
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 75%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.