PHF20 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PHF20 antibody: synthetic peptide directed towards the C terminal of human PHF20. Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	83 kDa
Gene Name	PHD finger protein 20
Database Link	NP_057520 Entrez Gene 51230 Human UniProt ID Q9BVI0
Background	PHF20 is a possible transcription factor.
Synonyms	C20orf104; GLEA2; HCA58; NZF; TDRD20A; TZP
Note	Immunogen Sequence Homology: Human: 100%; Pig: 92%; Bovine: 92%; Rabbit: 92%; Horse: 83%; Guinea pig: 83%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.