FCGRT Rabbit Polyclonal Antibody

CAT#: TA339394

Rabbit Polyclonal Anti-FCGRT Antibody



Need it in bulk or conjugated?
Get a free quote

CN¥ 5,200.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 2
    • 100 ug

CN¥ 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CN¥ 300.00
CN¥ 1,430.00


Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 20 µg
    • 20 ug

CN¥ 2,900.00
CN¥ 6,650.00


Recombinant protein of human Fc fragment of IgG, receptor, transporter, alpha (FCGRT), transcript variant 1, 100 µg
    • 100 ug

CN¥ 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FCGRT antibody: synthetic peptide directed towards the N terminal of human FCGRT. Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 40 kDa
Gene Name Fc fragment of IgG receptor and transporter
Background This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Synonyms alpha-chain; FCRN
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Mouse: 79%; Sheep: 79%; Bovine: 79%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...