MMP7 Rabbit Polyclonal Antibody
CNY 4,537.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MMP7 antibody: synthetic peptide directed towards the C terminal of human MMP7. Synthetic peptide located within the following region: AATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 19 kDa |
Gene Name | matrix metallopeptidase 7 |
Database Link | |
Background | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3. [provided by RefSeq, Jul 2008] |
Synonyms | MMP-7; MPSL1; PUMP-1 |
Note | Immunogen Sequence Homology: Human: 100%; Sheep: 100%; Bovine: 83%; Rabbit: 83%; Horse: 79%; Pig: 75%; Guinea pig: 75% |
Reference Data | |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Wnt signaling pathway |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Nobiletin is capable of regulating certain anti-cancer pathways in a colon cancer cell line.
,null,
Naunyn-Schmiedeberg's archives of pharmacology
,PubMed ID 36454256
[MMP7]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |