IFT172 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IFT172 antibody: synthetic peptide directed towards the N terminal of human IFT172. Synthetic peptide located within the following region: VKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	197 kDa
Gene Name	intraflagellar transport 172
Database Link	NP_056477 Entrez Gene 26160 Human UniProt ID Q9UG01
Background	IFT172 is required for the maintenance and formation of cilia. IT plays an indirect role in hedgehog (Hh) signaling, cilia being required for all activity of the hedgehog pathway.
Synonyms	BBS20; NPHP17; osm-1; RP71; SLB; SRTD10; wim
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.