ZNF33A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF33A antibody: synthetic peptide directed towards the middle region of human ZNF33A. Synthetic peptide located within the following region: LQKGDKGEKHFECNECGKAFWEKSHLTRHQRVHTGQKPFQCNECEKAFWD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	zinc finger protein 33A
Database Link	NP_008885 Entrez Gene 7581 Human UniProt ID Q06730
Background	ZNF33A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF33A may be involved in transcriptional regulation.
Synonyms	KOX2; KOX5; KOX31; NF11A; ZNF11; ZNF11A; ZNF33; ZZAPK
Note	Immunogen Sequence Homology: Human: 100%; Horse: 92%; Zebrafish: 92%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transcription Factors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.