SETD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SETD6 antibody: synthetic peptide directed towards the middle region of human SETD6. Synthetic peptide located within the following region: ELKDQDGGGDDKREEGSLTITNIPKLKASWRQLLQNSVLLTLQTYATDLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	SET domain containing 6
Database Link	NP_079136 Entrez Gene 79918 Human UniProt ID Q8TBK2
Background	The function of this protein remains unknown.
Synonyms	FLJ21148
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 87%; Pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.