AK2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-AK2 antibody: synthetic peptide directed towards the N terminal of human AK2. Synthetic peptide located within the following region: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	adenylate kinase 2
Database Link	NP_001616 Entrez Gene 204 Human UniProt ID P54819
Background	Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2. [provided by RefSeq, Nov 2010]
Synonyms	ADK2; AK 2
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 92%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Metabolic pathways, Purine metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.