DYRK1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Dyrk1a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	85 kDa
Gene Name	dual specificity tyrosine phosphorylation regulated kinase 1A
Database Link	NP_569120 Entrez Gene 13548 Mouse UniProt ID Q13627
Background	Dyrk1a may play a role in a signaling pathway regulating nuclear functions of cell proliferation. Dyrk1a phosphorylates serine, threonine and tyrosine residues in its sequence and in exogenous substrates.
Synonyms	DYRK; DYRK1; HP86; MNB; MNBH; MRD7
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.