SCN1B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	sodium voltage-gated channel beta subunit 1
Database Link	NP_001028 Entrez Gene 29686 Rat UniProt ID Q07699
Background	has voltage sensitive sodium channel activity when coexpressed with alpha subunits; plays a role in initiation and propogation of the action potential [RGD, Feb 2006]. Transcript Variant: This variant (2) lacks an internal segment in the 3' UTR, compared to variant 1. Both variants 1 and 2 encode the same isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns ERS160565, ERS240718 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## CDS uses downstream in-frame AUG :: upstream AUG and CDS extension is not conserved ##RefSeq-Attributes-END##
Synonyms	ATFB13; BRGDA5; GEFSP1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Sodium, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.