P2X2 (P2RX2) Rabbit Polyclonal Antibody

CAT#: TA338777

Rabbit Polyclonal Anti-P2RX2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 5
    • 100 ug

CNY 3,080.00


Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 2 (P2RX2), transcript variant 4
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2. Synthetic peptide located within the following region: VVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name purinergic receptor P2X 2
Background The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Binding to ATP mediates synaptic transmission between neurons and from neurons to smooth muscle. Multiple transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Aug 2013]
Synonyms DFNA41; P2X2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 86%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome, Ion Channels: ATP Receptors, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...